Intranasal delivery raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-09-16. Anything still debated is marked as such rather than presented as settled.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
Animal studies have examined behaviour in tests of anxiety, memory retention and stress response, and several report changes in neurotrophic or neurotransmitter-related markers. The human evidence base is much smaller, consisting mainly of short trials conducted in Russia with limited reporting in English-language journals. Sample sizes are modest and outcome measures vary between studies, so the findings are best described as preliminary. Independent replication under modern trial standards has not been widely reported.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
| Property | Value | Notes |
|---|---|---|
| Common route | Intranasal | Also injected in some animal work |
| Solubility class | Freely soluble in water | Solid form is hygroscopic |
| Typical storage | About -20 degrees Celsius | Keep desiccated and dark |
| Purity method | Reverse-phase HPLC | Reported as area percent |
| Confirmatory method | Mass spectrometry | Verifies expected molecular mass |
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
Lyophilized selank is normally supplied as a dry powder and is considered stable for extended periods when kept cold and dry. Moisture uptake is the main practical threat, because absorbed water promotes both hydrolysis and aggregation in the solid state. Vials are usually warmed to room temperature before opening so that condensation does not form on the powder. Supplier documentation commonly specifies -20 °C for routine storage, with -80 °C used for material intended to be archived for years.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Proteasomes are intricate membrane-less protein complexes responsible for the degradation of regulatory proteins, and damaged proteins in the cytosol and nucleus. They also function in protein homeostasis, stress response, and in the control of cell division and signal transduction.
The two substrates of this enzyme are L-α-glycerophosphoric acid, and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are dihydroxyacetonephosphoric acid, reduced NADH, and a proton. The enzyme can also use the alternative cofactor, nicotinamide adenine dinucleotide phosphate. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is sn-glycerol-3-phosphate:NAD(P)+ 2-oxidoreductase. Other names in common use include L-glycerol-3-phosphate:NAD(P)+ oxidoreductase, glycerol phosphate dehydrogenase (nicotinamide adenine dinucleotide, (phosphate)), glycerol 3-phosphate dehydrogenase (NADP+), and glycerol-3-phosphate dehydrogenase [NAD(P)+]. This enzyme participates in glycerophospholipid metabolism.
Attempts to reunite the Polish lands gained momentum in the 13th century, and in 1295, Duke Przemysł II of Greater Poland managed to become the first ruler since Bolesław II to be crowned king of Poland. He ruled over a limited territory and was soon killed. In 1300–1305 King Wenceslaus II of Bohemia also reigned as king of Poland. The Piast Kingdom was effectively restored under Władysław I the Elbow-high (r. 1306–1333), who became king in 1320. In 1308, the Teutonic Knights seized Gdańsk and the surrounding region of Pomerelia. King Casimir III the Great (r. 1333–1370), Władysław's son and the last of the Piast rulers, strengthened and expanded the restored Kingdom of Poland, but the western provinces of Silesia (formally ceded by Casimir in 1339) and most of Polish Pomerania were lost to the Polish state for centuries to come. Progress was made in the recovery of the separately governed central province of Mazovia, however, and in 1340, the conquest of Red Ruthenia began, marking Poland's expansion to the east. The Congress of Kraków, a vast convocation of central, eastern, and northern European rulers probably assembled to plan an anti-Turkish crusade, took place in 1364, the same year that the future Jagiellonian University, one of the oldest European universities, was founded. On 9 October 1334, Casimir III confirmed the privileges granted to Jews in 1264 by Bolesław the Pious and allowed them to settle in Poland in great numbers.
== Ownership and finance == Marks and Hazan initially supported GYG with their own money. In 2009, they sold a minority stake to Peter Ritchie, Guy Russo and Steve Jermyn, who had previously been involved with McDonald's Australia. Russo was subsequently appointed chairman of the board. The board also includes co-founder Robert Hazan, Tom Cowan of TDM Growth Partners, Rokt CEO Bruce Buchanan, and three former McDonalds executives. Investment firm TDM Growth Partners bought a stake in the company for $44 million in August 2018. In December 2020, the publicly listed Magellan Financial Group bought 10% of the company for $86.8 million. In May 2022, Magellan sold its 11.6% stake in the company to an entity owned by investment bank Barrenjoey Capital Partners for $140 million. Marks stated in 2019 that his goal was to list GYG on the Australian Securities Exchange. In 2020, he stated that he was also ambitious to expand the company's presence in the United States, citing Australia's "antiquated" labour laws, high rents, and expensive fresh produce. Marks resigned as CEO due to a health scare in May 2023, but he changed his mind and remained. Hilton Brett was appointed co-CEO in October 2023. GYG was listed on the Australian Securities Exchange on 20 June 2024.
=== Bioarchaeology === Entheses are widely recorded in the field of bioarchaeology, in which the presence of anomalies at these sites, called entheseal changes, has been used to infer repetitive loading to study the division of labour in past populations. Several different recording methods have been proposed to record the variety of changes seen at these sites. Previous studies have shown that, whichever recording method is used, certain entheseal changes occur more frequently in older individuals. Moreover, research demonstrates that diseases, such as ankylosing spondylitis and calcific tendinitis, also have to be taken into consideration. Nevertheless, experimental laboratory studies relying on virtual anthropological methods of analysis (e.g.,"Validated Entheses-based Reconstruction of Activity" 1.0 and 2.0 ) have demonstrated how loading history (physical activity) can increase the relative three-dimensional (3D) size of muscle attachment sites and their subtle surface changes.
Sources: en.wikipedia.org
The element emanates naturally from the ground, and some building materials, all over the world, wherever traces of uranium or thorium are found, and particularly in regions with soils containing granite or shale, which have a higher concentration of uranium. Not all granitic regions are prone to high emissions of radon. Being a rare gas, it usually migrates freely through faults and fragmented soils, and may accumulate in caves or water. Owing to its very short half-life (four days for 222Rn), radon concentration decreases very quickly when the distance from the production area increases. Radon concentration varies greatly with season and atmospheric conditions. For instance, it has been shown to accumulate in the air if there is a meteorological inversion and little wind. High concentrations of radon can be found in some spring waters and hot springs. The towns of Boulder, Montana; Misasa; Bad Kreuznach, Germany; and the country of Japan have radium-rich springs that emit radon. To be classified as a radon mineral water, radon concentration must be above 2 nCi/L (74 kBq/m3). The activity of radon mineral water reaches 2 MBq/m3 in Merano and 4 MBq/m3 in Lurisia (Italy). Natural radon concentrations in the Earth's atmosphere are so low that radon-rich water in contact with the atmosphere will continually lose radon by volatilization. Hence, ground water has a higher concentration of 222Rn than surface water, because radon is continuously produced by radioactive decay of 226Ra present in rocks.
== Structure == The human CRHR1 gene contains 14 exons over 20 kb of DNA, and its full gene product is a peptide composed of 444 amino acids. Excision of exon 6 yields in the mRNA for the primary functional CRF1, which is a peptide composed of 415 amino acids, arranged in seven hydrophobic alpha-helices. The CRHR1 gene is alternatively spliced into a series of variants. These variants are generated through deletion of one of the 14 exons, which in some cases causes a frame-shift in the open reading frame, and encode corresponding isoforms of CRF1. Though these isoforms have not been identified in native tissues, the mutations of the splice variants of mRNA suggest the existence of alternate CRF receptors, with differences in intracellular loops or deletions in N-terminus or transmembrane domains. Such structural changes suggest that the alternate CRF1 receptors have different degrees of capacity and efficiency in binding CRF and its agonists. Though the functions of these CRF1 receptors is yet unknown, they are suspected to be biologically significant. CRF1 is 70% homologous with the second human CRF receptor family, CRF2; the greatest divergence between the two lies at the N-terminus of the protein.
== In France == Raymond arrived in Europe in 1922 and settled in Paris in 1927. He nonetheless retained links with the newly formed republic of Turkey, and prepared sketches for Turkey's projected participation in the 1925 International Exposition of Decorative Arts in Paris.
1991: Invercargill re-proclaimed a city. 1992: Nelson-Marlborough Regional Council abolished by a Local Government Amendment Act. Of its territorial authorities, the Kaikōura District was transferred to the Canterbury Region, and Nelson City and Tasman and Marlborough districts became unitary authorities. 1995: The Chatham Islands County was dissolved and reconstituted by an Act of Parliament as the "Chatham Islands Territory", with powers similar to those of territorial authorities and some functions similar to those of a regional council. 2004: Tauranga became a city again on 1 March. 2006: The Banks Peninsula District merged into Christchurch as a result of a 2005 referendum. 2010: Auckland Council, a unitary authority, replaced seven local councils and the regional council. Reports on completed reorganisation proposals since 1999 are available on the Local Government Commission's site (link below).
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
SNX8 is thought to be an adaptor protein involved in the endosome-to-Golgi transport pathway, participating in endocytosis and endosomal sorting and signaling. It downregulates retrograde transport of intracellular proteins from the early endosome compartment to the trans-Golgi network in a retromer-mediated manner. SNX8 is therefore localized in early endosomes, as its colocalization with components of the retromer such as SNX1, SNX2, Vps26 and Vps35 has been demonstrated by some studies (and also with EEA1). Furthermore, the dynamics of endosomal structures with SNX8-enriched membrane domains are regulated by the opposite motor proteins dynein-1 containing LIC1 and kinesin-1, both of which allow SNX8-mediated cargo movement through the cytosol by exerting forces on these structures. The biological functions of SNX8 that have been studied, all of which involve its role in intracellular endosomal transport, are explained in more detail in the following sections.
Increase of the reactor power, and the increase of neutron flux, causes a rise in production of 135I and consumption of 135Xe. At first, the concentration of xenon decreases, then slowly increases again to a new equilibrium level as now excess 135I decays. During a typical power increase from 50 to 100%, the 135Xe concentration falls for about 3 hours. Decrease of the reactor power lowers production of new 135I, but also lowers the burn rate of 135Xe. For a while 135Xe builds up, governed by the amount of available 135I, then its concentration decreases again to an equilibrium for the given reactor power level. The peak concentration of 135Xe occurs after about 11.1 hours after power decrease, and then equilibrium is reached after about 50 hours. A total shutdown of the reactor is an extreme case of power decrease.
This allows the creation of a novel formulation that retains the smooth control of a long-acting basal with rapid-acting mealtime control from insulin aspart. This 2-component insulin retains the ultralow risk characteristics of degludec with simultaneous mealtime coverage.
The Ghana Police Service and the Criminal Investigation Department are the main law enforcement agencies, responsible for the detection of crime, maintenance of law and order and the maintenance of internal peace and security. The Ghana Police Service has eleven specialised police units, including a Militarized police Rapid deployment force and Marine Police Unit. The Ghana Police Service operates in 12 divisions: ten covering the regions of Ghana, one assigned specifically to the seaport and industrial hub of Tema, and the twelfth being the Railways, Ports and Harbours Division. The Ghana Police Service's Marine Police Unit and Division handles issues that arise from the country's offshore oil and gas industry.
Sources: en.wikipedia.org
Most published work uses intranasal application, either as drops or as a nasal spray. Injection routes appear in a smaller set of animal experiments. Oral use is uncommon in the literature because peptide breakdown and poor absorption limit this route.
Reported human trials are few, brief and originate mainly from one country. They describe effects on anxiety-related measures, but sample sizes are small and reporting is limited. The results are widely regarded as preliminary rather than confirmed.
Reverse-phase liquid chromatography is used to assess purity and separation of related impurities. Mass spectrometry confirms that the observed molecular mass matches the expected peptide. A certificate of analysis from the supplier is the usual document of record.
Purity is usually reported as an HPLC area percentage, most often measured at 214 nm. Identity is confirmed separately by mass spectrometry. A certificate of analysis should state both the method and the observed value.